On the Subject of Out of Time

Time remaining? Not on my watch!

7 8 9
4 5 6
1 2 3

This module presents a display with a counter, which can be increased using the keypad. The keypad has the layout shown on the right. The module’s keys do not show these values on the keypad, but letters instead.

Pressing a button on the keypad will increase the counter by its corresponding value. When the counter is greater than the bomb’s timer in seconds, the module will solve upon the next press.

The keypad buttons must be pressed in the correct order according to the sequence grid. Pressing a button out of order will issue a strike instead.

Press and hold the display to see the previous inputs. Find these in the grid and continue the sequence thence.

If there is a high amount of time left on the bomb, and thus a high number of presses are required, read the following section to speed up the process.

Backlighting

Red: Values are doubled.

Yellow: Value is multiplied by previous.

Green: Difference with previous value is added.

Cyan: Every button adds 10.

Blue: Values are squared.

Magenta: Buttons add minutes, not seconds.

White: Each press adds one more than the previous.

For every strike on the bomb, the colors cycle forward a rule.

Sometimes the backlighting will turn on, during which the counter or the values of the buttons behave differently. All effects are beneficial.

Use the color table to take note of which color corresponds to which effect. This lighting up happens at random.

The keypad and display are placed on pistons which allow them to extend as far out as the status light’s tip. If these pistons are extended, the module craves interaction. The further out the pistons are, the more cravings the module has.

Future cravings can be preemptively satisfied, and old forgotten cravings can still be as well. The display will flash a smiley face when any craving is satisfied.

When cravings are satisfied, the module is much more likely to light up when it’s among the last 5% of unsolved non-boss modules left on the bomb. Cravings cannot be satisfied after this point.

RUHUHCCUUSRHSXEEJSJVVUHSVRVHCRCJVXJHJEEVESCCRJSJCE
SERJCXRHCXXURXEEHURHRSJEXJVRHUUJUUERESHXSUEHSJRUUS
CXHUVJCVUEEHJXSVHXJHEJRSEUHXRJUCRHHXXHRJXHVXRRJCHX
RXAJUCVSUJCVXVJYOOAUOECECMASVMETTUAMAEYYMEOEUTCOAS
YMMMOOUAYSYOUCOEMEEYTATACMCTTMTGEAOSYGAGTSOMUYEUST
EAGYETUTGEEMMMTAMSOAESUYAGSGYMASSSGAGMOMEGMAATBAEY
MBTAAOUYOAYYETAMOWOBMMETETYTAMYAYATOTTAZMZBYTYTTZB
OAOMZWTMOZWMGZOWTGMWMOOWAOAYTGMYWWYYGOOWOAMTWAWMWY
GYWMAWBAWBOMMOTBWBOTBTAWYOZBTZABBBMAWMGWGTTTGTWWDO
WMTGOTZQOGQWBODYIZWIWQDQQGWWDGOYYYQDOWFYZDGBZDYWBF
ZDWDQIZIFGFIBIBYYDGZBIFBYYWDGDIIBBGDZWBDDWZQIBDLIW
IDWQWDLZGFGDFIZBBWZWIZLZZWFZGKZKZLKLQQZDKFKLQGKDKZ
DGDGZLLIIQKFBGGZLLGGBZIBBKIFBZBZKFLIDKKKDBDGFFILBQ
FKLLZQIKQFBBZZLLDFIGIQILBFDPFKKIILFNFDDLNLIDDZNNPZ
LPKKQNPZPLPKNIDKLVFVQNQQPPNVNFNKINILPPQDQKFPPQQINK
VKFNINFKDPPVLKPLINLLVDVILPQVKDFDFLXILNLFQPFFLIXPPQ
NLNVIQPXFKQVLILFLNKKNKKNFPKLXKLKKIJRQKRVPQKQXNFQXJ
PPCQJXFCCQNXNJQRNJQQXXPHFNHRRCXRRNPHRHHJFVPNRCNVXN
NCVJPJCHNCNNSSCPCJJNPPHNHJXSSRRVRHSVNNPXRNSRVCPSXR
UXPSCSJHJXJPRXRVSVCUVHHHUUHPVHCSURCPVJUVXPUXHHUCCJ

RUHUHCCUUSRHSXEEJSJVVUHSVRVHCRCJVXJHJEEVESCCRJSJCESERJCXRHCXXURXEEHURHRSJEXJVRHUUJUUERESHXSUEHSJRUUSCXHUVJCVUEEHJXSVHXJHEJRSEUHXRJUCRHHXXHRJXHVXRRJCHXRXAJUCVSUJCVXVJYOOAUOECECMASVMETTUAMAEYYMEOEUTCOASYMMMOOUAYSYOUCOEMEEYTATACMCTTMTGEAOSYGAGTSOMUYEUSTEAGYETUTGEEMMMTAMSOAESUYAGSGYMASSSGAGMOMEGMAATBAEYMBTAAOUYOAYYETAMOWOBMMETETYTAMYAYATOTTAZMZBYTYTTZBOAOMZWTMOZWMGZOWTGMWMOOWAOAYTGMYWWYYGOOWOAMTWAWMWYGYWMAWBAWBOMMOTBWBOTBTAWYOZBTZABBBMAWMGWGTTTGTWWDOWMTGOTZQOGQWBODYIZWIWQDQQGWWDGOYYYQDOWFYZDGBZDYWBFZDWDQIZIFGFIBIBYYDGZBIFBYYWDGDIIBBGDZWBDDWZQIBDLIWIDWQWDLZGFGDFIZBBWZWIZLZZWFZGKZKZLKLQQZDKFKLQGKDKZDGDGZLLIIQKFBGGZLLGGBZIBBKIFBZBZKFLIDKKKDBDGFFILBQFKLLZQIKQFBBZZLLDFIGIQILBFDPFKKIILFNFDDLNLIDDZNNPZLPKKQNPZPLPKNIDKLVFVQNQQPPNVNFNKINILPPQDQKFPPQQINKVKFNINFKDPPVLKPLINLLVDVILPQVKDFDFLXILNLFQPFFLIXPPQNLNVIQPXFKQVLILFLNKKNKKNFPKLXKLKKIJRQKRVPQKQXNFQXJPPCQJXFCCQNXNJQRNJQQXXPHFNHRRCXRRNPHRHHJFVPNRCNVXNNCVJPJCHNCNNSSCPCJJNPPHNHJXSSRRVRHSVNNPXRNSRVCPSXRUXPSCSJHJXJPRXRVSVCUVHHHUUHPVHCSURCPVJUVXPUXHHUCCJ

The Sequence Grid

This top grid is of size 50 by 20, with spacing every 5 characters for readability.

The bottom grid is identical, but without spacing. To assist with finding the previous inputs on the module, the first and last occurrences of each letter are bold and underlined respectively.

Each letter occurs exactly 38 or 39 times.

Note that the sequence is cyclic and has no real beginning and end.